Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255264.1 | internal | 127 | 1-381(+) |
Amino Acid sequence : | |||
KQAPMADAQRYALVTGANKGIGFEICRQLAEKGIXVILTSRNEKRGLEARKKLLKELNVSENRLVFHHLDVTDLASVAAVAVFIKSKFGKLDILVNNARVSGVDMVGDVSVFPSIYLRLE FSPLSFP | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,871.041 | ||
Theoretical pI: | 9.560 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 26.559 | ||
aromaticity | 0.071 | ||
GRAVY | 0.118 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.214 | ||
sheet | 0.286 |