Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255266.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
PSPKVTADKLVARFLEANSSAVSVKVGDDVQLAYTHSNQSPLLPRSFAVKDEIFCLFEGALDNLGSLKQQYGLAKSANXVLLVIEAYKTLRDRAPYPPNHVVGHLEGNFAFIVFDKSTST LFVATDPNAKVPLYLGNHC* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 12,326.311 | ||
Theoretical pI: | 11.236 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 73.498 | ||
aromaticity | 0.078 | ||
GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.175 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255266.1 | 3prime_partial | 104 | 312-1(-) |
Amino Acid sequence : | |||
MANNMIWRIRRPITKSLVCFDYQKHXVCRFGKTILLFQAPQVVECSFEQAEYLILNCKGSRQQRRLITVSVGQLDIVANLNGNRRRIRLEESSHQLIRRHFRRR | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,326.311 | ||
Theoretical pI: | 11.236 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
Instability index: | 73.498 | ||
aromaticity | 0.078 | ||
GRAVY | -0.417 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.175 | ||
sheet | 0.204 |