| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255267.1 | complete | 114 | 36-380(+) |
Amino Acid sequence : | |||
| MVMNKQIVLNNYINGSLKQSDLALRTSTICMEIPNGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTASELRERRTDLGVTSWMGGIYPYPKSI* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,086.933 | ||
| Theoretical pI: | 7.634 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44710 | ||
| Instability index: | 44.770 | ||
| aromaticity | 0.155 | ||
| GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.379 | ||
| turn | 0.223 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255267.1 | 3prime_partial | 103 | 139-447(+) |
Amino Acid sequence : | |||
| MAATVPFWSRTCTCPSILISFFAWENSISHSLIPSFLALLLLAMECQKYWIRPHPSYEKGELIWGSQAGWEEYTLIQNPYNLVKIQRQRCAFILLCWDSRNAW | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,086.933 | ||
| Theoretical pI: | 7.634 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44710 | ||
| Instability index: | 44.770 | ||
| aromaticity | 0.155 | ||
| GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
| Helix | 0.379 | ||
| turn | 0.223 | ||
| sheet | 0.272 | ||