Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255267.1 | complete | 114 | 36-380(+) |
Amino Acid sequence : | |||
MVMNKQIVLNNYINGSLKQSDLALRTSTICMEIPNGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTASELRERRTDLGVTSWMGGIYPYPKSI* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,086.933 | ||
Theoretical pI: | 7.634 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44710 | ||
Instability index: | 44.770 | ||
aromaticity | 0.155 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.379 | ||
turn | 0.223 | ||
sheet | 0.272 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255267.1 | 3prime_partial | 103 | 139-447(+) |
Amino Acid sequence : | |||
MAATVPFWSRTCTCPSILISFFAWENSISHSLIPSFLALLLLAMECQKYWIRPHPSYEKGELIWGSQAGWEEYTLIQNPYNLVKIQRQRCAFILLCWDSRNAW | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 12,086.933 | ||
Theoretical pI: | 7.634 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44710 | ||
Instability index: | 44.770 | ||
aromaticity | 0.155 | ||
GRAVY | 0.092 | ||
Secondary Structure Fraction | |||
Helix | 0.379 | ||
turn | 0.223 | ||
sheet | 0.272 |