Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255274.1	internal	180	3-542(+)
Amino Acid sequence :
ALKEKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECVVNGYTIPNKARIMINVWSMGRNPLYWEKPDTFWPERFDQVSKDFMGNDFEFVPFGAGRRICPGLNFGLANVEVPL AQLLYHFDWKLAEGMKPSDMDMSEAEGLTGNTKKTIFFLFPTPYDPSSMINHLLLPPIKT
Physicochemical properties
Number of amino acids:		180
Molecular weight:		20,804.911
Theoretical pI:		5.962
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		34950 35075
Instability index:		34.808
aromaticity		0.117
GRAVY		-0.353
Secondary Structure Fraction
Helix		0.311
turn		0.250
sheet		0.244