Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255277.1	5prime_partial	166	1-501(+)
Amino Acid sequence :
IKMAPEEDSLALAEAWNHGFGFIKTSIVKTAVELEIPDILESRGAPVSIPELATAVDCSADRIYRVMRFLAYHGIFKRTKPPPESTEGGSVYYAQTPVSRRLTRENLGPFVLLQGTMREP SGCVTAETLRTSKRPGVVNENESDHLYEDPVFSMKVFRDAMATMLG*
Physicochemical properties
Number of amino acids:		166
Molecular weight:		18,392.837
Theoretical pI:		5.676
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		45.575
aromaticity		0.078
GRAVY		-0.221
Secondary Structure Fraction
Helix		0.283
turn		0.235
sheet		0.289