| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255280.1 | internal | 129 | 2-388(+) |
Amino Acid sequence : | |||
| EDILLKVAAQVPDSGPCVTYIGKGGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLSNEELHQVFTQWNKGELLSFLIEITADIFGVKDDKGNGHLVDKSPRQNWNEGYPENGRFNQA AELLHLQLP | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,269.913 | ||
| Theoretical pI: | 4.949 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 23.429 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.264 | ||
| sheet | 0.256 | ||