Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255281.1	internal	129	2-388(+)
Amino Acid sequence :
AHEIGTLWRDSAIQETYFRGNELQLPDCAHFFMENLQRLSDADYVPTKEDVLYARVRTTGVVEIQFSPVGENKKSGEVYRLFDVGGQKNERRKWIHLFEGVSAVIFCAAISEYDQTLFED DNKNRMMET
Physicochemical properties
Number of amino acids:		129
Molecular weight:		14,972.592
Theoretical pI:		4.939
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		38.618
aromaticity		0.116
GRAVY		-0.526
Secondary Structure Fraction
Helix		0.310
turn		0.178
sheet		0.256