| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255284.1 | internal | 159 | 3-479(+) |
Amino Acid sequence : | |||
| EVQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVDMVGDVSVFHEYIEADFKALQAL EAGAKEDPPFKPKATGEMIEQFQGATDCFVSNYYGPKRL | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,476.885 | ||
| Theoretical pI: | 6.201 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 23.050 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.060 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.195 | ||
| sheet | 0.289 | ||