Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255289.1	internal	200	3-602(+)
Amino Acid sequence :
ELEYVKRIFYASEDVRGKQLHDIAVRMLSRLANRSDLQEVQNHIMSFFTETNSERPGNYVESRKELPLRNQEGSNGIGGSSQGAAWMKPVYPAKAPLLGDPVSLIHDFDVNKNDKYAVNM DLQPKSRKEPIFDELDSIVRIKMAEAKMFQARRRRCKKGIRSSETHCSVPKVKESKKIPKPDPPLRLTEAEEMRKQKVEE
Physicochemical properties
Number of amino acids:		200
Molecular weight:		22,997.068
Theoretical pI:		9.353
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13075
Instability index:		69.624
aromaticity		0.060
GRAVY		-0.849
Secondary Structure Fraction
Helix		0.245
turn		0.235
sheet		0.260