Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255291.1 | 5prime_partial | 143 | 1-432(+) |
Amino Acid sequence : | |||
FGFIRQDEMSRLLRHLQSSAGETVDMTERIATLTCSIICRAAFGAIINDHEELVELVKDSLSMASGFELADLFPSSKLLNLLCWNKSKLWRMRRRVYTILEAIVDEHKLKKSGEFGGEDI IDVLFRMPQGTARSKSPSPTNAI* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,131.482 | ||
Theoretical pI: | 7.020 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 58.290 | ||
aromaticity | 0.070 | ||
GRAVY | -0.113 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.210 | ||
sheet | 0.301 |