Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255304.1 | 5prime_partial | 156 | 2-472(+) |
Amino Acid sequence : | |||
ARRSRSNRLEIQAAGSTYGTYFRVTTFGESHGGGVGCVIDGCPPRLPLTEDDMQVDLDRRRPGQSRITTPRKETDTCKISSGTADGFTTGSPIKVEVPHTDQRGNDYTEMSQAYRPSHAD ATYDFKYGVRSVQGGGRSLPEKQLGELLQELLPRKF* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 13,067.838 | ||
Theoretical pI: | 9.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 51.748 | ||
aromaticity | 0.119 | ||
GRAVY | -0.014 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.322 | ||
sheet | 0.195 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255304.1 | 3prime_partial | 118 | 355-2(-) |
Amino Acid sequence : | |||
MRWPIGLRHFSVVISSLICMGHFYLDRGSRGESISSPGRNFACVCLLSRGGYSALTWPPSIKIYLHIIFCEGKSRRASINYTAYSSTMRFSERRNTEVGSVRTAGSLYFEAIGAGSTS | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,067.838 | ||
Theoretical pI: | 9.867 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20190 | ||
Instability index: | 51.748 | ||
aromaticity | 0.119 | ||
GRAVY | -0.014 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.322 | ||
sheet | 0.195 |