Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255311.1	internal	203	2-610(+)
Amino Acid sequence :
EDSLALAEAWNHGFGFIKTSIVKTAVELEIPDILESRGAPVSIPELATAVDCSADRIYRVMRFLAYHGIFKRTKPPPESTEGGSVYYAQTPVSRRLTRENLGPFVLLQGTMREPSGCVTA ETLRTSKRPGVVNENESDHLYEDPVFSMKVFRDAMASHARMTTAAVIENTVKVFKVSGLWWISRFVRNGLSILVKASWLRGIC
Physicochemical properties
Number of amino acids:		203
Molecular weight:		17,462.515
Theoretical pI:		10.004
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		40.192
aromaticity		0.045
GRAVY		-0.665
Secondary Structure Fraction
Helix		0.248
turn		0.293
sheet		0.223

Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255311.1	5prime_partial	157	610-137(-)
Amino Acid sequence :
ADPPKPGSLHQNRETIPYEPRNPPKTRHLENLHRIFDHCRCRHPSMARHSIPKNLHTENRIFVQVVRLVLIDNAGSFARPQGLRRHTPGWLSHGALKQHEGPQILPSEAARDRGLSVVNR TALGRLGWRLGSLEDAVIGQEPHDSVYAVSGAVDSGG*
Physicochemical properties
Number of amino acids:		157
Molecular weight:		17,462.515
Theoretical pI:		10.004
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		40.192
aromaticity		0.045
GRAVY		-0.665
Secondary Structure Fraction
Helix		0.248
turn		0.293
sheet		0.223