Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255316.1 | 5prime_partial | 142 | 3-431(+) |
Amino Acid sequence : | |||
QAPMADAQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARKKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVQMVGDVSVFNEYIEADFK ALQALEAGAKEDRHLSQKPMEK* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,555.822 | ||
Theoretical pI: | 8.705 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 20.648 | ||
aromaticity | 0.056 | ||
GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.183 | ||
sheet | 0.324 |