Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255320.1	internal	204	2-613(+)
Amino Acid sequence :
KQAPMADAQRHALVTGANKGIGFEICRQLAEKGIIVILTARNEKRGIEAQQKLLKELNVSENHLVFHQLDVTDPASVAAIAVFVKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADF KALQALEAGAKEEVPFKPKANGEMIEKFEGAKDCVETNYYGPKRLTQALIPLLQLSPSPKIVTSPPPPEFTALWNKWAKGFPAT
Physicochemical properties
Number of amino acids:		204
Molecular weight:		22,226.415
Theoretical pI:		7.030
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		38.239
aromaticity		0.074
GRAVY		-0.123
Secondary Structure Fraction
Helix		0.304
turn		0.221
sheet		0.304