| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255321.1 | 5prime_partial | 171 | 3-518(+) |
Amino Acid sequence : | |||
| RSEPLSVAPFALAMSDPVYTETWHHLSEWFHNDAVAAFDTKYGMTFPEYAVADDRLNVLFNEAMACDAGFVNSILTTECREIFDGLESMVDVGGGTGATAKGIAAAFPGMECTVLDLPNV VGGLKGSENLSFVSGDMFHFIPHADAIFMKFILHDWNDEDCLKILKKCQPQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 12,557.325 | ||
| Theoretical pI: | 10.681 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 58.665 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.347 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255321.1 | 3prime_partial | 143 | 431-3(-) |
Amino Acid sequence : | |||
| MRNKMKHVPTNKAQILRPFEATYNIRKVKHSTFHPGEGGGDPLRRGSGAAADINHRFQAIKDLSTLRSENTIHKARITSHGLIEQHVQPIVSHRVLRERHPVFGIECSHSIVVEPFAQMV PRLCVDGVRHGERKRRHAQGLAP | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 12,557.325 | ||
| Theoretical pI: | 10.681 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 58.665 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.347 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255321.1 | complete | 118 | 412-56(-) |
Amino Acid sequence : | |||
| MSPLTKLRFSDPLRPPTTFGRSSTVHSIPGKAAAIPFAVAPVPPPTSTIDSKPSKISLHSVVRILFTKPASQAMASLNNTFNLSSATAYSGNVIPYLVSNAATASLWNHSLRWCHVSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 12,557.325 | ||
| Theoretical pI: | 10.681 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
| Instability index: | 58.665 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.347 | ||
| sheet | 0.212 | ||