| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255322.1 | complete | 145 | 36-473(+) |
Amino Acid sequence : | |||
| MTAVTSFTFLLVPMLFQMCLSVPRYLQVMEKARVAMLQLQLLLLVVDLNLALIQTWILNLLLHLEYQWKRKGQGKKQLQRRLRKKVQHRKKGNSSLLHRDATMTESVNPGTSEPEKKTNG LMDDENALLQQALAMSMDDSPLQLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 11,736.614 | ||
| Theoretical pI: | 4.374 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.766 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.304 | ||
| sheet | 0.357 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255322.1 | 5prime_partial | 115 | 2-349(+) |
Amino Acid sequence : | |||
| KLEALLAAVNNNDSSHIVHVPPGPNALSDVLISTPIFTGDGEGASGYVAAAAAAAGGGFEFGVDPNLDPELALALRVSMEEERARQEAAAKKAQEEGSTSEKGEQQSTSQGCNND* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 11,736.614 | ||
| Theoretical pI: | 4.374 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.766 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.304 | ||
| sheet | 0.357 | ||