Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255322.1 | complete | 145 | 36-473(+) |
Amino Acid sequence : | |||
MTAVTSFTFLLVPMLFQMCLSVPRYLQVMEKARVAMLQLQLLLLVVDLNLALIQTWILNLLLHLEYQWKRKGQGKKQLQRRLRKKVQHRKKGNSSLLHRDATMTESVNPGTSEPEKKTNG LMDDENALLQQALAMSMDDSPLQLL* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 11,736.614 | ||
Theoretical pI: | 4.374 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 42.766 | ||
aromaticity | 0.035 | ||
GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.304 | ||
sheet | 0.357 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255322.1 | 5prime_partial | 115 | 2-349(+) |
Amino Acid sequence : | |||
KLEALLAAVNNNDSSHIVHVPPGPNALSDVLISTPIFTGDGEGASGYVAAAAAAAGGGFEFGVDPNLDPELALALRVSMEEERARQEAAAKKAQEEGSTSEKGEQQSTSQGCNND* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 11,736.614 | ||
Theoretical pI: | 4.374 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 42.766 | ||
aromaticity | 0.035 | ||
GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.304 | ||
sheet | 0.357 |