Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255325.1 | internal | 181 | 2-544(+) |
Amino Acid sequence : | |||
FFGRFSVVAMSDSSKLTVLVTGAGGRTGQIAYKKLKERSDQYISRGLVRTPESKEKVGGEDDVYVGDIRNSESIASAIQGIDALIILTSAVPKMKPGFDPAKGGRPEFYFEDGAFPEQVD WDWTEESNRCRQSCWSEAYCVGRIDGRNESQSPLNSLGNGNILVWKKKAEHIWLIRGIPIP | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,046.398 | ||
Theoretical pI: | 6.816 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35075 | ||
Instability index: | 50.812 | ||
aromaticity | 0.094 | ||
GRAVY | -0.435 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.282 | ||
sheet | 0.199 |