Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255330.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
TSELVGWVKDVFQHCAPSWDRDALIRELDFVSRIFRGSEDPRGRKLFWKCEELIEKLKSGVAEPVACKIILIFFQELEADPSKNQESEDGRMISPQEAFNKIADVVQEAVKNMDIPTTNT RCGW* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,230.050 | ||
Theoretical pI: | 4.959 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22250 | ||
Instability index: | 42.480 | ||
aromaticity | 0.089 | ||
GRAVY | -0.412 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.194 | ||
sheet | 0.250 |