Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255334.1	5prime_partial	191	2-577(+)
Amino Acid sequence :
KLEITIVQAQFQQELKETSRWWHSTSLVQQLPFVRDRIVECYYWTTGVLERREHGYERIMLTKINALVTTIDDIYDIYGTFEELQLFTNAIKRWDIESMNQLPPYMQQCYLALQNFVNEM AYNTLKQKGFNSIPYLHKTWVDLVEAYMREAEWYHNGHKPSLEEYMNNAWISIRRRPDFIPYLFLCYRFYR*
Physicochemical properties
Number of amino acids:		191
Molecular weight:		23,351.449
Theoretical pI:		6.244
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		60850 60975
Instability index:		50.139
aromaticity		0.162
GRAVY		-0.463
Secondary Structure Fraction
Helix		0.377
turn		0.152
sheet		0.251