Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255335.1	5prime_partial	206	3-623(+)
Amino Acid sequence :
GFEICRQLAEKGIIVILTARNEKRGIEAQQKLLKELNVSENHLVFHQLDVTDPASVAAIAVFVKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQALEAGAKEEVPFKPKAN GEMIEKFEGAKDCVETNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGMLGDKDRLTEERVTKLWRFPXXXKXT*
Physicochemical properties
Number of amino acids:		206
Molecular weight:		22,461.696
Theoretical pI:		6.243
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		32.267
aromaticity		0.079
GRAVY		-0.116
Secondary Structure Fraction
Helix		0.337
turn		0.213
sheet		0.307