Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255337.1 | complete | 176 | 31-561(+) |
Amino Acid sequence : | |||
MLRQILSTITGLRGDNGFGWASTAEEVTRGIDATNLTAIVTGGSGGIGLETARVLALRNARVIIAARNMDSANEAKQLILESNKTARVHVLKLDLASFKSVKAFADSFISLDLPLNILIN NAGIMFCPYQLSQDGIEIQFATNYLGHFYLTNLLLEKMKETAKATGIEGRIVNLSR* | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 14,763.507 | ||
Theoretical pI: | 11.164 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 41.607 | ||
aromaticity | 0.067 | ||
GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.246 | ||
sheet | 0.328 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255337.1 | 3prime_partial | 134 | 404-3(-) |
Amino Acid sequence : | |||
MIPALFMRMLRGRSREMKLSAKALTDLKEAKSSLRTWTRAVLLLSSISCFASFAESMFLAAIITRAFLNARTLAVSSPIPPEPPVTMAVRLVASIPRVTSSAVEAHPKPLSPRNPVIVLR ICLNIFSLYKTSYS | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,763.507 | ||
Theoretical pI: | 11.164 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 41.607 | ||
aromaticity | 0.067 | ||
GRAVY | 0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.246 | ||
sheet | 0.328 |