| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255338.1 | 5prime_partial | 158 | 1-477(+) |
Amino Acid sequence : | |||
| VKMIHNGIEYGDMQLISEAYDVLKSVGKLSNEELKDVFTDWNKGELQSFLIEITADIFGIKDDKADGFLVDKVLDKTGMKGTGKWTVQQAAELSIAAPTIEASLDSRFMSGLKEERTEAA KVFNFGDIIGDQEVDKEKLIHDVRQALYASKICSYHKV* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,635.859 | ||
| Theoretical pI: | 4.907 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 33.282 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.171 | ||
| sheet | 0.266 | ||