| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255345.1 | 5prime_partial | 137 | 2-415(+) |
Amino Acid sequence : | |||
| VAAFDTKYGMTFPEYAVADDRLNVLFNEAMACDAGFVNSILTTECREIFDGLESMVDVGGGTGATAKGIAAAFPGMECTVLDLPNVVGGLKGSENLSFVSGDMFHFIPXADAIFMKFILH DWNDXECVQILKKCQEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 11,908.352 | ||
| Theoretical pI: | 10.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 67.816 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.699 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.238 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255345.1 | 3prime_partial | 105 | 316-2(-) |
Amino Acid sequence : | |||
| MKHIPTNKAQILRPFEATYNIRKVKHSTFHPGEGGGDPLRRGSGAAADINHRFQAIEDLSTLRSENTIHKARITSHGLIEQHVQPIVSHRVLRERHPVFGIERSH | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,908.352 | ||
| Theoretical pI: | 10.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 67.816 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.699 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.238 | ||
| sheet | 0.200 | ||