Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255349.1	internal	216	3-650(+)
Amino Acid sequence :
WLSWINRINGVDAEVEKVGTKLDGSMEGILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGTDTTFAALEWTMAELIKNPRTLKTLQNEVREVSRNKGGITED DVDKMPYLKAVSKGDSTPTSPFRNSAPSRIDSRRQYAPATTSPVGTVVVGQQLGLIERPSLWGKSRKNSSRKVLQGGGPVPIRPIVSRITIPWASF
Physicochemical properties
Number of amino acids:		216
Molecular weight:		24,048.051
Theoretical pI:		9.421
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31970 31970
Instability index:		44.013
aromaticity		0.065
GRAVY		-0.518
Secondary Structure Fraction
Helix		0.282
turn		0.255
sheet		0.194