Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255363.1 | 3prime_partial | 182 | 547-2(-) |
Amino Acid sequence : | |||
MIWGSTDRRVHLHVSFTTDFMYLSSAVSSPSSSSRSGPLSPPPALSPSTAGFLISSASTHRVVVEDVSVPAENVSKMKALMELVVMGTLIWVSFCILKRTSMMSSPPNSPLFLNLCSSTM ASRMVSTRRRILQSLLLFQQRRLRSLEEGNMSASSNPEAMLSASLTSPTSSALSLITLPNAA | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 13,126.400 | ||
Theoretical pI: | 11.758 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 94.381 | ||
aromaticity | 0.009 | ||
GRAVY | -1.520 | ||
Secondary Structure Fraction | |||
Helix | 0.158 | ||
turn | 0.228 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255363.1 | 5prime_partial | 169 | 3-512(+) |
Amino Acid sequence : | |||
AAFGSVIRDNAELVGLVKDALSMASGFELADMFPSSKLLNLLCWNKSKLWRMRRRVDTILEAIVDEHKFKKSGEFGGEDIIDVLFRMQKDTQIKVPITTNSIKAFIFDTFSAGTETSSTT TLWVLAELMRNPAVDGESAGGGDSGPEREDELGLDTAELKYMKSVVKET* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 13,126.400 | ||
Theoretical pI: | 11.758 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 94.381 | ||
aromaticity | 0.009 | ||
GRAVY | -1.520 | ||
Secondary Structure Fraction | |||
Helix | 0.158 | ||
turn | 0.228 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255363.1 | 5prime_partial | 114 | 2-346(+) |
Amino Acid sequence : | |||
GGVRERDQGQRGAGGAGQGRAQHGLGVRARRHVPLLQAPQPPLLEQEQALEDAPPRRHHPRGHRRRAQVQEERRVRRRGHHRRPLQDAEGHPDQSPHHHQLHQSLHLRYVLSRD* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 13,126.400 | ||
Theoretical pI: | 11.758 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 94.381 | ||
aromaticity | 0.009 | ||
GRAVY | -1.520 | ||
Secondary Structure Fraction | |||
Helix | 0.158 | ||
turn | 0.228 | ||
sheet | 0.237 |