Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255369.1 | 3prime_partial | 195 | 46-630(+) |
Amino Acid sequence : | |||
MSGPQCCENPPTLNPSSGSGQVQEFGGLTSYISGPSDSKAAVILISDVFGYDAPNLRKLADKIAATGFLTVVPDFLKGDPYKPEDKPISDWIKDHGPDQAFENAKPVIEALKSKGITKIG AAGFCWGAKVVVELAKYAYINAAVLLHPSFVFLEDIQGVKVPYLYLELKSTECSPPEPNKQFEMALNAKHENQLL | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 21,085.872 | ||
Theoretical pI: | 5.220 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 33.053 | ||
aromaticity | 0.092 | ||
GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.277 | ||
sheet | 0.256 |