Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255372.1	5prime_partial	182	2-550(+)
Amino Acid sequence :
GGPRMSAAKACDAFVQLADSCGYAVAVMPSAKGLVPEHHPHIIGTYWGTVSTPLCAEIVESADAYLIAGPVFSDASTVGYSLLLKKEKGIIVHPDCVVIGNGPTFGCVLMKNFLMAHAKR VRLNTSGYENYRKIHVANGHPLKSGPNEVLKVNVLFHYIHNICRKKRLLSLKQXDLGLIATT*
Physicochemical properties
Number of amino acids:		182
Molecular weight:		19,523.619
Theoretical pI:		9.154
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15930 16305
Instability index:		28.851
aromaticity		0.072
GRAVY		0.145
Secondary Structure Fraction
Helix		0.326
turn		0.249
sheet		0.249