Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255374.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
KTLRDPRGFAVKFYTREFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKVNYVKFHWKPTCGVKCLLEDEAVKIGGANHSHATQ DLYDSIAAGELSRVETFYSDYRS* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 11,640.512 | ||
Theoretical pI: | 5.741 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
Instability index: | 63.025 | ||
aromaticity | 0.091 | ||
GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.222 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255374.1 | complete | 99 | 315-614(+) |
Amino Acid sequence : | |||
MKLLRLEEPITAMPLRISTTRLQQGNYPEWKLFIQTIDPEIEDRFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNIHNSLLKMNSLPSAWLLLSWGLLFR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,640.512 | ||
Theoretical pI: | 5.741 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
Instability index: | 63.025 | ||
aromaticity | 0.091 | ||
GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.222 | ||
sheet | 0.293 |