| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255374.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
| KTLRDPRGFAVKFYTREFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKVNYVKFHWKPTCGVKCLLEDEAVKIGGANHSHATQ DLYDSIAAGELSRVETFYSDYRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 11,640.512 | ||
| Theoretical pI: | 5.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 63.025 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.222 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255374.1 | complete | 99 | 315-614(+) |
Amino Acid sequence : | |||
| MKLLRLEEPITAMPLRISTTRLQQGNYPEWKLFIQTIDPEIEDRFDFDPLDVTKTWPEDIIPLQPVGRLVLNKNIHNSLLKMNSLPSAWLLLSWGLLFR* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,640.512 | ||
| Theoretical pI: | 5.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 63.025 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.145 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.222 | ||
| sheet | 0.293 | ||