| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255375.1 | 5prime_partial | 196 | 1-591(+) |
Amino Acid sequence : | |||
| AIIRGKIDFEREPWPSISDSAKSLVKLMLEPDPKLRLTAKQVLEHSWLQNAKKAPNVPLGDVVKSRLKQFSMMNRFKRKALRIIAEFLSNEEVEGIREIFSKIDTDNDGVVSVEELKAGL LKVNGQMAESEVQMLIEAVDTNGKGTLDYGEFLAISLHLQKMANDEHLPKASPISTKMEMVTLSMMSSKCLNGRRI* | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 14,585.603 | ||
| Theoretical pI: | 8.307 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
| Instability index: | 63.399 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.341 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255375.1 | 3prime_partial | 135 | 407-3(-) |
Amino Acid sequence : | |||
| MSICTSDSAICPLTFNNPALSSSTETTPSLSVSILENISLIPSTSSLDKNSAMILRAFLLNLFIIENCFSRDLTTSPRGTFGAFFAFCSQECSRTCFAVSRSFGSGSSINFTRLLALSEI LGHGSRSKSIFPRMM | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,585.603 | ||
| Theoretical pI: | 8.307 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 375 | ||
| Instability index: | 63.399 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.305 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.341 | ||
| sheet | 0.237 | ||