Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255381.1 | 5prime_partial | 133 | 2-403(+) |
Amino Acid sequence : | |||
GALLLCDMAHISGLVAAQEAADPFEYCDIVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQAMAPGFKAYAKQVRANAVALGKL FDEQRVLSCHWWN* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 11,418.727 | ||
Theoretical pI: | 8.452 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 62.794 | ||
aromaticity | 0.095 | ||
GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.362 | ||
sheet | 0.171 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255381.1 | 5prime_partial | 105 | 626-309(-) |
Amino Acid sequence : | |||
GGGFSDLARILFWNKPPWISGGGVPDGNSPQEPTAMVSPNTAFLFNSNVAQITEFLNLVSSQSKRWKIPQNQMVFSSTSDKIVPFAHQIVSQAQQHSPSLALHTP* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,418.727 | ||
Theoretical pI: | 8.452 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 62.794 | ||
aromaticity | 0.095 | ||
GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.362 | ||
sheet | 0.171 |