| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255381.1 | 5prime_partial | 133 | 2-403(+) |
Amino Acid sequence : | |||
| GALLLCDMAHISGLVAAQEAADPFEYCDIVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVALKQAMAPGFKAYAKQVRANAVALGKL FDEQRVLSCHWWN* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 11,418.727 | ||
| Theoretical pI: | 8.452 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 62.794 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.362 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255381.1 | 5prime_partial | 105 | 626-309(-) |
Amino Acid sequence : | |||
| GGGFSDLARILFWNKPPWISGGGVPDGNSPQEPTAMVSPNTAFLFNSNVAQITEFLNLVSSQSKRWKIPQNQMVFSSTSDKIVPFAHQIVSQAQQHSPSLALHTP* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,418.727 | ||
| Theoretical pI: | 8.452 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 62.794 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.362 | ||
| sheet | 0.171 | ||