| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255382.1 | 5prime_partial | 144 | 3-437(+) |
Amino Acid sequence : | |||
| LALAEAWNHGFGFIKTSIVKTAVELEIPDILESRGAPVSIPELATAVDCSADRIYRVMRFLAYHGIFKRTKPPPESTEGGSVYYAQTPVSRRLTRENLGSFMLLQGTMREPSGCVTAETL RTSKRPALSMRTNPTTCTKIRFSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,937.234 | ||
| Theoretical pI: | 9.551 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 37.147 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.168 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.236 | ||
| sheet | 0.264 | ||