Acc_NO	ORF type	length	start-end position (strand +/-)
>AW255384.1	5prime_partial	155	3-470(+)
Amino Acid sequence :
SVFNEYIEADFKALQALEAGAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDEHRLTEERVDEVVEVFLKDIKEGK LEESQWPPHFAAERVSKAALNAYTKIAAKNSRVSA*
Physicochemical properties
Number of amino acids:		155
Molecular weight:		17,290.499
Theoretical pI:		5.528
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22460
Instability index:		32.514
aromaticity		0.090
GRAVY		-0.331
Secondary Structure Fraction
Helix		0.310
turn		0.226
sheet		0.335