| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255385.1 | 5prime_partial | 167 | 1-504(+) |
Amino Acid sequence : | |||
| LKMTKNDLLSRVESGKDVRHFEFEAVSISIDYDVGDILEVLPGQNPEALDAFMQRCNLNPESYITVQARDDENHGFLRPSSPVKLKSFVELTMDVASASPRRYFFEVMSFFATAEHEKER LQYFASPEGRDDLYQYNQKERRTVLEVLEDFPSVQMPFEWFVQLVPH* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,475.682 | ||
| Theoretical pI: | 4.789 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 47.867 | ||
| aromaticity | 0.120 | ||
| GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.204 | ||
| sheet | 0.275 | ||