| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255394.1 | internal | 206 | 3-620(+) |
Amino Acid sequence : | |||
| ATVLAIGTAVPLNCVDQSAYPDYYFRITNSEHKTELKEKFKRMCEKSMIKKRYMHLTEEYLKENPNITAYMAPSLDARQDIVVVEVPKLGKEAAHKAIKEWGQPKSKITHLVFCTTSGVD MPGADFQLTKLLGLRPSVKRFMMYQQGCFAGSTVLRMAKDLAREQRRRRVLIVCSEITAVTFRGPSDAHLQSLVGQALFGERGPAV | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 11,900.002 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 101.917 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.569 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.233 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255394.1 | 5prime_partial | 194 | 620-36(-) |
Amino Acid sequence : | |||
| NGGAPFAEEGLPDEALEVGVAGAAECDGGDLGADDEDAAPALFSGEVLGHAEDGASGEAALLVHHEALDGGAEAEELGQLEVGARHVDAAGGTEDEVGDLGLGLTPLLDRLVRRLLPQLR HLHHHDVLPRVQRRRHVGGDVRVLLKVLLRQMHVPFLYHRFLAHALEFLFEFGLMFAVGDAEVVIRIGTLVDAV* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 11,900.002 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 101.917 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.569 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.233 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255394.1 | 5prime_partial | 103 | 619-308(-) |
Amino Acid sequence : | |||
| TAGPRSPKRACPTRLWRWASLGPRNVTAVISEQTMRTRRRRCSRARSLAMRRTVLPAKQPCWYIMKRLTEGRRPRSLVSWKSAPGMSTPLVVQKTRWVILDLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,900.002 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 101.917 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.569 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.233 | ||
| sheet | 0.223 | ||