| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255396.1 | 5prime_partial | 169 | 2-511(+) |
Amino Acid sequence : | |||
| KMVHENKKKVCVTGGTGFLGSWMIKRLLEDGYYVNATVRLDPERKRNISYITDLPGAAERLQIFNADLDKPETFAPAVEGCGGVFHMAHPLDFAEKETEEVKLKRVTAAMQGILQACADS KTVRRVVYTSSISAVAFSTAANPGGTIDRTRGPTSTSSAASRGSPGRTS* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 15,601.704 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 83.884 | ||
| aromaticity | 0.069 | ||
| GRAVY | -1.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.244 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255396.1 | 3prime_partial | 131 | 241-633(+) |
Amino Acid sequence : | |||
| MRRRLPHGPPTRLRRERDGGGEAEARHRRDARHSAGLRRLEDGPPSGLHLQHLRRRLQHRRQPRRHHRQNSWTDVDFIRSLKGFAGPYIVTKTWRKRTPYIWPRISARSLSLFRLGLRPF HLPNLPDSVQV | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 15,601.704 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 83.884 | ||
| aromaticity | 0.069 | ||
| GRAVY | -1.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.244 | ||
| sheet | 0.198 | ||