Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255396.1 | 5prime_partial | 169 | 2-511(+) |
Amino Acid sequence : | |||
KMVHENKKKVCVTGGTGFLGSWMIKRLLEDGYYVNATVRLDPERKRNISYITDLPGAAERLQIFNADLDKPETFAPAVEGCGGVFHMAHPLDFAEKETEEVKLKRVTAAMQGILQACADS KTVRRVVYTSSISAVAFSTAANPGGTIDRTRGPTSTSSAASRGSPGRTS* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 15,601.704 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 83.884 | ||
aromaticity | 0.069 | ||
GRAVY | -1.135 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.244 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255396.1 | 3prime_partial | 131 | 241-633(+) |
Amino Acid sequence : | |||
MRRRLPHGPPTRLRRERDGGGEAEARHRRDARHSAGLRRLEDGPPSGLHLQHLRRRLQHRRQPRRHHRQNSWTDVDFIRSLKGFAGPYIVTKTWRKRTPYIWPRISARSLSLFRLGLRPF HLPNLPDSVQV | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 15,601.704 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
Instability index: | 83.884 | ||
aromaticity | 0.069 | ||
GRAVY | -1.135 | ||
Secondary Structure Fraction | |||
Helix | 0.244 | ||
turn | 0.244 | ||
sheet | 0.198 |