| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255397.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
| NGKREEARRQGSHRNRRRQRHRRGHRPPLRRARRPRSGDRRHAAREGRYRGGIHRRPAVQLRPLRHHRRATGQVRRGLDRRHLRRRRRDVLQRRHRQRHRSDRPGPGTGALQPRDACLRP SHGGVAFKHAGAVIIGGTGGRAALSSCTAQVANG | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 13,957.835 | ||
| Theoretical pI: | 9.252 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 21.077 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.182 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255397.1 | complete | 132 | 3-401(+) |
Amino Acid sequence : | |||
| MASVKKLAGKVAIVTGGASGIGEVTARLFAERGARAVVIADMQPEKGGTVAESIGGRRCSYVHCDITDEQQVRSVVDWTAATYGGVDVMFCNAGTASATAQTVLDLELAHFNRVMRVYAR RTAALRLNTRAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 13,957.835 | ||
| Theoretical pI: | 9.252 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 21.077 | ||
| aromaticity | 0.053 | ||
| GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.182 | ||
| sheet | 0.288 | ||