Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255397.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
NGKREEARRQGSHRNRRRQRHRRGHRPPLRRARRPRSGDRRHAAREGRYRGGIHRRPAVQLRPLRHHRRATGQVRRGLDRRHLRRRRRDVLQRRHRQRHRSDRPGPGTGALQPRDACLRP SHGGVAFKHAGAVIIGGTGGRAALSSCTAQVANG | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 13,957.835 | ||
Theoretical pI: | 9.252 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 21.077 | ||
aromaticity | 0.053 | ||
GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.182 | ||
sheet | 0.288 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255397.1 | complete | 132 | 3-401(+) |
Amino Acid sequence : | |||
MASVKKLAGKVAIVTGGASGIGEVTARLFAERGARAVVIADMQPEKGGTVAESIGGRRCSYVHCDITDEQQVRSVVDWTAATYGGVDVMFCNAGTASATAQTVLDLELAHFNRVMRVYAR RTAALRLNTRAP* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 13,957.835 | ||
Theoretical pI: | 9.252 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 21.077 | ||
aromaticity | 0.053 | ||
GRAVY | 0.071 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.182 | ||
sheet | 0.288 |