Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255405.1 | internal | 160 | 2-481(+) |
Amino Acid sequence : | |||
FFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLEVVFDKIRYSRDTKLSILIVLLGAAVCTITDVSVNAKGFAAAFIAVWSTALQQYYVHYLQRKYSLTSFNLLGHTAPAQAGSLLL VGPLLDYWLTSKRIDEFQFHLPSMVVMILSWTIGRWGTEI | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,965.951 | ||
Theoretical pI: | 8.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
Instability index: | 33.472 | ||
aromaticity | 0.138 | ||
GRAVY | 0.618 | ||
Secondary Structure Fraction | |||
Helix | 0.438 | ||
turn | 0.200 | ||
sheet | 0.263 |