| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255405.1 | internal | 160 | 2-481(+) |
Amino Acid sequence : | |||
| FFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLEVVFDKIRYSRDTKLSILIVLLGAAVCTITDVSVNAKGFAAAFIAVWSTALQQYYVHYLQRKYSLTSFNLLGHTAPAQAGSLLL VGPLLDYWLTSKRIDEFQFHLPSMVVMILSWTIGRWGTEI | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,965.951 | ||
| Theoretical pI: | 8.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38055 | ||
| Instability index: | 33.472 | ||
| aromaticity | 0.138 | ||
| GRAVY | 0.618 | ||
Secondary Structure Fraction | |||
| Helix | 0.438 | ||
| turn | 0.200 | ||
| sheet | 0.263 | ||