| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255409.1 | internal | 209 | 2-628(+) |
Amino Acid sequence : | |||
| IFDTFSAGTETSSTTTLWVLAELMRNPAVMAKAQAEVRAALKEKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECVVNGYTIPNKARIMINVWSMGRNPLYWEKPDTFWPER FDQVSKDFMGNDFEFVPFGAGRRICPGLNFRLANVEVPLATSLPLRLEIGGRNETSDMDMSEAEGLTGILKNNLLLFHHPTILLLIISF | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 11,279.823 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 57.288 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.376 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255409.1 | 3prime_partial | 103 | 309-1(-) |
Amino Acid sequence : | |||
| MDQTLIMILALFGIVYPLTTHSSLHDLGINGIGGCILIVSFTTDFMYLSSCTSSTSQFVFSFSAALTSACAFAITAGFLISSASTHRVVVEDVSVPAENVSKM | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,279.823 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 57.288 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.376 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255409.1 | 5prime_partial | 101 | 630-325(-) |
Amino Acid sequence : | |||
| AKEMIRRRIVGWWNKRRLFFSIPVRPSASDMSISEVSFLPPISSRSGKEVANGTSTFANRKFKPGQILLPAPNGTNSKSFPMKSFETWSNLSGQKVSGFSQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,279.823 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 57.288 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.376 | ||
| sheet | 0.168 | ||