Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255417.1 | 5prime_partial | 199 | 2-601(+) |
Amino Acid sequence : | |||
AKRAAHGFFELPLEERRKYLKENSPTPAVMLRTSFSPFADQVLEWKDALVLLAGKQNEGSRFWHPVYRDRLLEYINLARPLIKKLLEVLLKGINVNQIDEAKESSLMGSLGVQLLHYPTC PDPSLAAGASPHSDVSSFTLLLQDEVGGLYVRSGEGNGWIHVVPIKGSLVVNIGDVLQIMSHEIYKNVEHRIFLVERSE* | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 22,341.452 | ||
Theoretical pI: | 6.425 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 45.738 | ||
aromaticity | 0.080 | ||
GRAVY | -0.125 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.246 | ||
sheet | 0.296 |