Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255419.1 | internal | 204 | 1-612(+) |
Amino Acid sequence : | |||
QRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARQKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEADFKALQALEA GAKEEPPFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFRNFTATVERMGKGSVGRQGQLTKE | |||
Physicochemical properties | |||
Number of amino acids: | 204 | ||
Molecular weight: | 22,343.530 | ||
Theoretical pI: | 9.186 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 27.094 | ||
aromaticity | 0.069 | ||
GRAVY | -0.134 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.230 | ||
sheet | 0.284 |