| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255423.1 | 3prime_partial | 190 | 48-617(+) |
Amino Acid sequence : | |||
| MGVNVPRIKLGSQGLEVSKQGLGCMGMSAFYGPPKPDSDMIKLIHHAIDSGVTFLDTSDMYGPHTNEILIGKALKGGMREKVQLATKFGIIMGVGKSDVRGDPAYVRSSCESSLKRLDVD CIDLYYVHRIDTSVPIEVTMGELKKLVEEGKIKYIGLSEASPSTIKRAHAVHPITAVQIKWSLWSREAQA | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,742.888 | ||
| Theoretical pI: | 8.694 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 34.165 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.247 | ||
| sheet | 0.232 | ||