| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255437.1 | complete | 192 | 40-618(+) |
Amino Acid sequence : | |||
| MVMNKQIVFNNYINGSLKQSDLALRTSTICMEIPDGCNGAILVKNLYLSVNPYLILRMGKLDIPQFDSILPGSTIVSYGVSKVLDSTHPSYEKGELIWGSQAGWEEYTLIQNPYNLFKIQ DKDVPLSYYVGILGMPGMTAYAGFFEICSPKKGETVFVTAAAGSVGPLVGQFAKMFGCYVVGSAGSKRRLIF* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 21,020.226 | ||
| Theoretical pI: | 8.274 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27640 | ||
| Instability index: | 34.799 | ||
| aromaticity | 0.115 | ||
| GRAVY | 0.177 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.286 | ||
| sheet | 0.219 | ||