| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255440.1 | 5prime_partial | 158 | 3-479(+) |
Amino Acid sequence : | |||
| YSGEDKAQDFMDVMVSAVKGANFECEYDVDTIIKATCGTLIAGGTDTTAVVFIWALALLLNNPHVLQKAQHELDTHVGKQRRVDESDLNNLVYLQAITKETLRLYPPGPLGGTRRLTRDC HVGGYHIPKETWLIVNLWKLHRDPRIWSDPSEFRPKSF* | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 17,877.178 | ||
| Theoretical pI: | 6.315 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 30.820 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.313 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.196 | ||
| sheet | 0.234 | ||