| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255441.1 | 5prime_partial | 160 | 3-485(+) |
Amino Acid sequence : | |||
| FGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCGWLRPDGKTQVT VEYRNEGGAMVPIXVHTVLISTQHDETVTNDQIAADLKDT* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 15,484.515 | ||
| Theoretical pI: | 4.599 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 30.218 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.315 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255441.1 | 3prime_partial | 144 | 434-3(-) |
Amino Acid sequence : | |||
| MLSGDENCVNXNRNHGTSLISVLNSDLSLAIGPQPSASLVLPHFGELGPELGCEDVSEWHQLWSLISGIPEHMPLVTSSNFFGFLGEMTVNSLGNIRALLFDVDKDLAVVSIKTNIRRCE SNTPASITNYLLIVDLCLGCDLTK | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,484.515 | ||
| Theoretical pI: | 4.599 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 30.218 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.188 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.315 | ||
| sheet | 0.266 | ||