Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255461.1 | 5prime_partial | 172 | 1-519(+) |
Amino Acid sequence : | |||
LILIHRLLKRNPSSSSCYMLNYSCYKPSDNLKLGTEASCRVVHRNKNLGWEQYKFLLKTIVSSGLGEETYCPQNVLAGKEADPSLADSLQELDDIFFQTIDDLFEKSRISPQEIDILVVN VSLLSPSPSLSSRIINRYKMRPDIKASISPAWAAAPASSPSTRAPSFQDLQE* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 18,788.334 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 77.541 | ||
aromaticity | 0.036 | ||
GRAVY | -0.806 | ||
Secondary Structure Fraction | |||
Helix | 0.224 | ||
turn | 0.315 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255461.1 | complete | 165 | 114-611(+) |
Amino Acid sequence : | |||
MQSRPPQQKPRMGAVQVPPQNHRQLRPRRGNLLPSKRPCRQGSRPLSRRLSPRTRRHLLPNHRRSLRKIPNLTPRNRHPRSQRLPAFTLSVAVVEDHQPIQNEARHQSLNLSGMGCSASL VAVDSCAVFSRFTRINSPSSSAPNLWAQLGIADQQIDDAVNWLFR* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,788.334 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 77.541 | ||
aromaticity | 0.036 | ||
GRAVY | -0.806 | ||
Secondary Structure Fraction | |||
Helix | 0.224 | ||
turn | 0.315 | ||
sheet | 0.200 |