| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255466.1 | internal | 141 | 2-424(+) |
Amino Acid sequence : | |||
| PFKPKANGEMIEKFEGAKDCVVTNYYGPKRLTQALIPLLQLSPSPRIVNVSSSFGSLLLLWNEWAKGVLGDEDRLTEERVDEVVEVFLKDIKEGKLEESQWPPHFAAERVSKAALNAYTK IAAKKYPSFPHKCNMPGLCEN | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 12,219.772 | ||
| Theoretical pI: | 8.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 54.600 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.348 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255466.1 | 5prime_partial | 115 | 423-76(-) |
Amino Acid sequence : | |||
| FSHNPGILHLCGKLGYFFAAILVYAFNAAFETLSAAKCGGHWLSSSLPSFISLRKTSTTSSTLSSVSLSSSPNTPFAHSFHSSSKLPKEEETLTILGEGDSCKRGMRACVSLFGP* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,219.772 | ||
| Theoretical pI: | 8.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 54.600 | ||
| aromaticity | 0.104 | ||
| GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.348 | ||
| sheet | 0.252 | ||