| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255471.1 | 5prime_partial | 200 | 2-604(+) |
Amino Acid sequence : | |||
| LNIVQAHFQQELXESFRWWRNTGFVEKLPFARDRLVECYFWNTGIIEPRQHASARIMMGKVNALITVIDDIYDVYGTLEELEHFTDLIRRWDIDSIDQLPDYMQLCFLALNNFVDETSYD VMKEKGVNVIPYLRQSWVDLADKYMVXARWFYGGHKPSLGRVFGKLMDVDKWALHVDTIFFRVTDSSTKETVDSLSISPI* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 23,298.357 | ||
| Theoretical pI: | 5.091 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50420 50545 | ||
| Instability index: | 41.316 | ||
| aromaticity | 0.136 | ||
| GRAVY | -0.163 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.167 | ||
| sheet | 0.222 | ||