| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255472.1 | internal | 201 | 2-604(+) |
Amino Acid sequence : | |||
| DGGDDFNRILIKVIKLLGSFNVGDYVPWLSWINRINGVDAEVEKVGTKLDGSMEGILRKYRRKKVGDDETNFVDTLLQFQRESKDTDPVEDDVIKALIFDMVSAGTDTTFAALEWTMAEL IKNPRTLKTLQNEVREVSRNKGGITEDDVDKMPYLKAVSKGDSTPTSTFRNSAPSRIDSRPNMLGYDIPRGTVVLVTTGPY | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,466.155 | ||
| Theoretical pI: | 5.068 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
| Instability index: | 22.044 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.234 | ||
| sheet | 0.199 | ||