| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255479.1 | 5prime_partial | 152 | 3-461(+) |
Amino Acid sequence : | |||
| ENEHVGKNMSDNPLNTIFVPSKVPVNQSLIQTVGITKLGVYIEASSGFGQSKDSIHCDHGIASAEIGQLSTIPPKQRTHAAIHDFRNRKRNLPREAFQGGFILEKIARPLSQGEVKLSNT NVDENPSITFNYFSHPEDVARCVDGIRISKGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 11,389.301 | ||
| Theoretical pI: | 8.734 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 35.830 | ||
| aromaticity | 0.139 | ||
| GRAVY | 0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.287 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW255479.1 | complete | 101 | 385-80(-) |
Amino Acid sequence : | |||
| MEGFSSTLVFESLTSPCESGRAIFSRMKPPWKASRGRFRFRFLKSWIAACVLCFGGMVESWPISAEAMPWSQWMLSLDCPKPLLASIYTPNFVIPTVCISD* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,389.301 | ||
| Theoretical pI: | 8.734 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 35.830 | ||
| aromaticity | 0.139 | ||
| GRAVY | 0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.287 | ||
| sheet | 0.248 | ||