Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255480.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
VSFTHTIKAMEPFFTVLLSALFFGEIPSPWVVSSLVPIVGGVALASFTEVSFNWIGFGTAMASNLTNQTRNVFSKKFMGKTXESLDNINLFSIITIISFLFLVPAAILMEGVKFSPSYLQ YAASEGLNVKELCVRTLLSGLCFHTYQQVSYVILRMVNR* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 11,959.067 | ||
Theoretical pI: | 10.004 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 25.280 | ||
aromaticity | 0.037 | ||
GRAVY | -0.194 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.224 | ||
sheet | 0.308 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW255480.1 | 3prime_partial | 108 | 326-3(-) |
Amino Acid sequence : | |||
MRMAAGTRNKNDMIVMMEKRLMLSKLXSVFPMNFLLNTFRVWLVRLEAMAVPKPIQLNETSVNDANATPPTIGTREETTHGEGISPKKRAESKTVKKGSIALIVCVKE | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,959.067 | ||
Theoretical pI: | 10.004 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 25.280 | ||
aromaticity | 0.037 | ||
GRAVY | -0.194 | ||
Secondary Structure Fraction | |||
Helix | 0.262 | ||
turn | 0.224 | ||
sheet | 0.308 |